Lineage for d6txrb2 (6txr B:151-316)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999405Species Plasmodium vivax [TaxId:5855] [389428] (1 PDB entry)
  8. 2999407Domain d6txrb2: 6txr B:151-316 [389436]
    Other proteins in same PDB: d6txra1, d6txrb1, d6txrc1, d6txrd1
    automated match to d5hs4a2
    complexed with da, dc, dg, du, o0q

Details for d6txrb2

PDB Entry: 6txr (more details), 2.5 Å

PDB Description: structural insights into cubane-modified aptamer recognition of a malaria biomarker
PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6txrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6txrb2 d.162.1.1 (B:151-316) automated matches {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali

SCOPe Domain Coordinates for d6txrb2:

Click to download the PDB-style file with coordinates for d6txrb2.
(The format of our PDB-style files is described here.)

Timeline for d6txrb2: