| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
| Protein automated matches [226882] (10 species) not a true protein |
| Species Plasmodium vivax [TaxId:5855] [389428] (1 PDB entry) |
| Domain d6txrb2: 6txr B:151-316 [389436] Other proteins in same PDB: d6txra1, d6txrb1, d6txrc1, d6txrd1 automated match to d5hs4a2 complexed with da, dc, dg, du, o0q |
PDB Entry: 6txr (more details), 2.5 Å
SCOPe Domain Sequences for d6txrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6txrb2 d.162.1.1 (B:151-316) automated matches {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali
Timeline for d6txrb2: