Lineage for d6txra1 (6txr A:3-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844943Species Plasmodium vivax [TaxId:5855] [389426] (1 PDB entry)
  8. 2844944Domain d6txra1: 6txr A:3-150 [389432]
    Other proteins in same PDB: d6txra2, d6txrb2, d6txrc2, d6txrd2
    automated match to d2a92a1
    complexed with da, dc, dg, du, o0q

Details for d6txra1

PDB Entry: 6txr (more details), 2.5 Å

PDB Description: structural insights into cubane-modified aptamer recognition of a malaria biomarker
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6txra1:

Sequence, based on SEQRES records: (download)

>d6txra1 c.2.1.5 (A:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnafi
ivvtnpvdvmvqllfehsgvpknkiigl

Sequence, based on observed residues (ATOM records): (download)

>d6txra1 c.2.1.5 (A:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkanrddllplnnkimieigghiknlcpnafiivvtnpvd
vmvqllfehsgvpknkiigl

SCOPe Domain Coordinates for d6txra1:

Click to download the PDB-style file with coordinates for d6txra1.
(The format of our PDB-style files is described here.)

Timeline for d6txra1: