SCOPe 2.08: Domain d6txrb1: 6txr B:3-150

Lineage for d6txrb1 (6txr B:3-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [389426] (1 PDB entry)

8. Domain d6txrb1: 6txr B:3-150 [389435]
   Other proteins in same PDB: d6txra2, d6txrb2, d6txrc2, d6txrd2
   automated match to d2a92a1
   complexed with da, dc, dg, du, o0q

Details for d6txrb1

PDB Entry: 6txr, 2.5 Å

PDB Description: structural insights into cubane-modified aptamer recognition of a malaria biomarker

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6txrb1:

Sequence, based on SEQRES records:

>d6txrb1 c.2.1.5 (B:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkapgksdkewnrddllplnnkimieigghiknlcpnafi
ivvtnpvdvmvqllfehsgvpknkiigl

Sequence, based on observed residues (ATOM records):

>d6txrb1 c.2.1.5 (B:3-150) automated matches {Plasmodium vivax [TaxId: 5855]}
pkpkivlvgsgmiggvmatlivqknlgdvvmfdvvknmpqgkaldtshsnvmaysnckvt
gsnsyddlkgadvvivtagftkarddllplnnkimieigghiknlcpnafiivvtnpvdv
mvqllfehsgvpknkiigl

Timeline for d6txrb1:

• d6txrb1 first appeared in SCOPe 2.07