Lineage for d6l4zg_ (6l4z G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039002Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 3039003Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 3039016Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 3039017Protein automated matches [324386] (3 species)
    not a true protein
  7. 3039028Species Zika virus [TaxId:64320] [327137] (14 PDB entries)
  8. 3039043Domain d6l4zg_: 6l4z G: [389241]
    Other proteins in same PDB: d6l4zb_, d6l4zd_, d6l4zf_, d6l4zh_
    automated match to d5gpig_
    complexed with e5x

Details for d6l4zg_

PDB Entry: 6l4z (more details), 1.9 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 6
PDB Compounds: (G:) Genome polyprotein

SCOPe Domain Sequences for d6l4zg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l4zg_ g.96.1.0 (G:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslvee

SCOPe Domain Coordinates for d6l4zg_:

Click to download the PDB-style file with coordinates for d6l4zg_.
(The format of our PDB-style files is described here.)

Timeline for d6l4zg_: