SCOPe 2.08: Domain d6l4zh_: 6l4z H:

Lineage for d6l4zh_ (6l4z H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (12 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327129] (7 PDB entries)

8. Domain d6l4zh_: 6l4z H: [389255]
   Other proteins in same PDB: d6l4za_, d6l4zc_, d6l4ze_, d6l4zg_
   automated match to d5gpih_
   complexed with e5x

Details for d6l4zh_

PDB Entry: 6l4z, 1.9 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 6

PDB Compounds: (H:) Genome polyprotein

SCOPe Domain Sequences for d6l4zh_:

Sequence, based on SEQRES records:

>d6l4zh_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]}
evkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgd
vkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldyp
agtsgspildkcgrviglygngvvikngsyvsaitqgkr

Sequence, based on observed residues (ATOM records):

>d6l4zh_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]}
evkkgettdgvyrvmttqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
pildkcgrviglygngvvikngsyvsaitqgkr

Timeline for d6l4zh_:

• d6l4zh_ first appeared in SCOPe 2.07