SCOPe 2.08: Domain d6l4za_: 6l4z A:

Lineage for d6l4za_ (6l4z A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [327137] (14 PDB entries)

8. Domain d6l4za_: 6l4z A: [389251]
   Other proteins in same PDB: d6l4zb_, d6l4zd_, d6l4zf_, d6l4zh_
   automated match to d5gj4a1
   complexed with e5x

Details for d6l4za_

PDB Entry: 6l4z, 1.9 Å

PDB Description: crystal structure of zika ns2b-ns3 protease with compound 6

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d6l4za_:

Sequence; same for both SEQRES and ATOM records:

>d6l4za_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

Timeline for d6l4za_:

• d6l4za_ first appeared in SCOPe 2.07