SCOP 1.55: Domain d1egab2: 1ega B:183-296

Lineage for d1egab2 (1ega B:183-296)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (3 superfamilies)

4. Superfamily d.52.3: Ribosomal protein S3 N-terminal domain-like [54814] (1 family)

5. Family d.52.3.1: Ribosomal protein S3 N-terminal domain-like [54815] (2 proteins)

6. Protein GTPase Era C-terminal domain [54818] (1 species)

7. Species Escherichia coli [TaxId:562] [54819] (1 PDB entry)

8. Domain d1egab2: 1ega B:183-296 [38837]
   Other proteins in same PDB: d1egaa1, d1egab1

Details for d1egab2

PDB Entry: 1ega, 2.4 Å

PDB Description: crystal structure of a widely conserved gtpase era

SCOP Domain Sequences for d1egab2:

Sequence; same for both SEQRES and ATOM records:

>d1egab2 d.52.3.1 (B:183-296) GTPase Era C-terminal domain {Escherichia coli}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg

Timeline for d1egab2:

• d1egab2 appears in SCOP 1.57
  
• d1egab2 appears in the current release, SCOPe 2.08