Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) automatically mapped to Pfam PF00958 |
Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein) |
Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species) |
Species Escherichia coli [TaxId:562] [54813] (1 PDB entry) |
Domain d1gpma3: 1gpm A:405-525 [38826] Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2 complexed with amp, cit, mg, po4, pop |
PDB Entry: 1gpm (more details), 2.2 Å
SCOPe Domain Sequences for d1gpma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpma3 d.52.2.1 (A:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli [TaxId: 562]} gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew e
Timeline for d1gpma3: