| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GMP synthetase [52319] (2 species) |
| Species Escherichia coli [TaxId:562] [52320] (1 PDB entry) |
| Domain d1gpmb2: 1gpm B:3-207 [31406] Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3 complexed with amp, cit, mg, po4, pop |
PDB Entry: 1gpm (more details), 2.2 Å
SCOPe Domain Sequences for d1gpmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpmb2 c.23.16.1 (B:3-207) GMP synthetase {Escherichia coli [TaxId: 562]}
enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
evthtrqgmrmlerfvrdicqceal
Timeline for d1gpmb2: