SCOPe 2.05: Domain d1gpmc3: 1gpm C:405-525

Lineage for d1gpmc3 (1gpm C:405-525)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families)
   automatically mapped to Pfam PF00958

5. Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)

6. Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)

7. Species Escherichia coli [TaxId:562] [54813] (1 PDB entry)

8. Domain d1gpmc3: 1gpm C:405-525 [38828]
   Other proteins in same PDB: d1gpma1, d1gpma2, d1gpmb1, d1gpmb2, d1gpmc1, d1gpmc2, d1gpmd1, d1gpmd2
   complexed with amp, cit, mg, po4, pop

Details for d1gpmc3

PDB Entry: 1gpm, 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

PDB Compounds: (C:) gmp synthetase

SCOPe Domain Sequences for d1gpmc3:

Sequence; same for both SEQRES and ATOM records:

>d1gpmc3 d.52.2.1 (C:405-525) GMP synthetase C-terminal dimerisation domain {Escherichia coli [TaxId: 562]}
gpglgvrvlgevkkeycdllrradaifieelrkadlydkvsqaftvflpvrsvgvmgdgr
kydwvvslravetidfmtahwahlpydflgrvsnriinevngisrvvydisgkppatiew
e

Timeline for d1gpmc3:

• d1gpmc3 first appeared (with stable ids) in SCOP 1.55
  
• d1gpmc3 appears in SCOPe 2.04
  
• d1gpmc3 appears in SCOPe 2.06
  
• d1gpmc3 appears in the current release, SCOPe 2.08