Lineage for d6p6ul1 (6p6u L:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844354Protein Lactate dehydrogenase [51859] (19 species)
  7. 2844696Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (3 PDB entries)
  8. 2844716Domain d6p6ul1: 6p6u L:1-159 [388107]
    Other proteins in same PDB: d6p6ua2, d6p6ub2, d6p6uc2, d6p6ud2, d6p6ue2, d6p6uf2, d6p6ug2, d6p6uh2, d6p6ui2, d6p6uj2, d6p6uk2, d6p6ul2, d6p6um2, d6p6un2, d6p6uo2, d6p6up2
    automated match to d5nqba1
    complexed with amp

Details for d6p6ul1

PDB Entry: 6p6u (more details), 2.42 Å

PDB Description: crystal structure of monoclinic rabbit muscle lactate dehydrogenase with four tetramers as the asymmetric unit
PDB Compounds: (L:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6p6ul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p6ul1 c.2.1.5 (L:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d6p6ul1:

Click to download the PDB-style file with coordinates for d6p6ul1.
(The format of our PDB-style files is described here.)

Timeline for d6p6ul1: