SCOPe 2.08: Domain d6p6up1: 6p6u P:1-159

Lineage for d6p6up1 (6p6u P:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (3 PDB entries)

8. Domain d6p6up1: 6p6u P:1-159 [388025]
   Other proteins in same PDB: d6p6ua2, d6p6ub2, d6p6uc2, d6p6ud2, d6p6ue2, d6p6uf2, d6p6ug2, d6p6uh2, d6p6ui2, d6p6uj2, d6p6uk2, d6p6ul2, d6p6um2, d6p6un2, d6p6uo2, d6p6up2
   automated match to d5nqba1
   complexed with amp

Details for d6p6up1

PDB Entry: 6p6u, 2.42 Å

PDB Description: crystal structure of monoclinic rabbit muscle lactate dehydrogenase with four tetramers as the asymmetric unit

PDB Compounds: (P:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d6p6up1:

Sequence; same for both SEQRES and ATOM records:

>d6p6up1 c.2.1.5 (P:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d6p6up1:

• d6p6up1 first appeared in SCOPe 2.07