Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein Lactate dehydrogenase [51859] (19 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (3 PDB entries) |
Domain d5nqba1: 5nqb A:1-159 [333815] Other proteins in same PDB: d5nqba2, d5nqbb2, d5nqbc2, d5nqbd2 automated match to d4i9ha1 complexed with mli |
PDB Entry: 5nqb (more details), 1.58 Å
SCOPe Domain Sequences for d5nqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nqba1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
Timeline for d5nqba1: