SCOPe 2.08: Domain d5nqba1: 5nqb A:1-159

Lineage for d5nqba1 (5nqb A:1-159)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
Protein Lactate dehydrogenase [51859] (19 species)
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (3 PDB entries)
Domain d5nqba1: 5nqb A:1-159 [333815]
Other proteins in same PDB: d5nqba2, d5nqbb2, d5nqbc2, d5nqbd2
automated match to d4i9ha1
complexed with mli

Details for d5nqba1

PDB Entry: 5nqb (more details), 1.58 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with malonate

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqba1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5nqba1:

Click to download the PDB-style file with coordinates for d5nqba1.
(The format of our PDB-style files is described here.)

Timeline for d5nqba1: