SCOP 1.55: Domain d1vewd2: 1vew D:91-205

Lineage for d1vewd2 (1vew D:91-205)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (3 species)

7. Species Escherichia coli [TaxId:562] [54722] (5 PDB entries)

8. Domain d1vewd2: 1vew D:91-205 [38694]
   Other proteins in same PDB: d1vewa1, d1vewb1, d1vewc1, d1vewd1

Details for d1vewd2

PDB Entry: 1vew, 2.1 Å

PDB Description: manganese superoxide dismutase from escherichia coli

SCOP Domain Sequences for d1vewd2:

Sequence; same for both SEQRES and ATOM records:

>d1vewd2 d.44.1.1 (D:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayylkfqnrrpdyikefwnvvnwdeaaarfaakk

Timeline for d1vewd2:

• d1vewd2 appears in SCOP 1.57
  
• d1vewd2 appears in the current release, SCOPe 2.08