Lineage for d1f95a_ (1f95 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31762Fold d.39: Dynein light chain 8 (DLC8) [54647] (1 superfamily)
  4. 31763Superfamily d.39.1: Dynein light chain 8 (DLC8) [54648] (1 family) (S)
  5. 31764Family d.39.1.1: Dynein light chain 8 (DLC8) [54649] (1 protein)
  6. 31765Protein Dynein light chain 8 (DLC8) [54650] (2 species)
  7. 31769Species Rat (Rattus norvegicus) [TaxId:10116] [54652] (3 PDB entries)
  8. 31772Domain d1f95a_: 1f95 A: [38555]

Details for d1f95a_

PDB Entry: 1f95 (more details)

PDB Description: solution structure of dynein light chain 8 (dlc8) and bim peptide complex

SCOP Domain Sequences for d1f95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f95a_ d.39.1.1 (A:) Dynein light chain 8 (DLC8) {Rat (Rattus norvegicus)}
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

SCOP Domain Coordinates for d1f95a_:

Click to download the PDB-style file with coordinates for d1f95a_.
(The format of our PDB-style files is described here.)

Timeline for d1f95a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f95b_