Lineage for d1mpyc2 (1mpy C:146-307)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549597Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2549722Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
  7. 2549723Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
  8. 2549729Domain d1mpyc2: 1mpy C:146-307 [38513]
    complexed with acn, fe2

Details for d1mpyc2

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2
PDB Compounds: (C:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d1mpyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpyc2 d.32.1.3 (C:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]}
maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih
hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne
vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt

SCOPe Domain Coordinates for d1mpyc2:

Click to download the PDB-style file with coordinates for d1mpyc2.
(The format of our PDB-style files is described here.)

Timeline for d1mpyc2: