SCOPe 2.06: Domain d1mpyc2: 1mpy C:146-307

Lineage for d1mpyc2 (1mpy C:146-307)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)

7. Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)

8. Domain d1mpyc2: 1mpy C:146-307 [38513]
   complexed with acn, fe2

Details for d1mpyc2

PDB Entry: 1mpy, 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2

PDB Compounds: (C:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d1mpyc2:

Sequence; same for both SEQRES and ATOM records:

>d1mpyc2 d.32.1.3 (C:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]}
maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih
hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne
vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt

Timeline for d1mpyc2:

• d1mpyc2 first appeared (with stable ids) in SCOP 1.55
  
• d1mpyc2 appears in SCOPe 2.05
  
• d1mpyc2 appears in SCOPe 2.07
  
• d1mpyc2 appears in the current release, SCOPe 2.08