Lineage for d1eila2 (1eil A:133-289)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (3 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (3 proteins) Protein 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) [54603] (2 species) 
Species Pseudomonas sp. [TaxId:306] [54604] (5 PDB entries) 
Domain d1eila2: 1eil A:133-289 [38503]
Details for d1eila2
PDB Entry: 1eil (more details), 2 Å
PDB Description: 2,3-dihydroxybiphenyl-1,2-dioxygenase
SCOP Domain Sequences for d1eila2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eila2 d.32.1.3 (A:133-289) 2,3-Dihydroxybiphenyl dioxygenase (DHDB, BPHC enzyme) {Pseudomonas sp.}
vsgfvtgdqgighfvrcvpdtakamafytevlgfvlsdiidiqmgpetsvpahflhcngr
hhtialaafpipkrihhfmlqantiddvgyafdrldaagritsllgrhtndqtlsfyadt
pspmievefgwgprtvdsswtvarhsrtamwghksvr
SCOP Domain Coordinates for d1eila2:
Click to download the PDB-style file with coordinates for d1eila2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eila2:
- d1eila2 appears in SCOP 1.57
- d1eila2 appears in the current release, SCOPe 2.08
View in 3D
