SCOPe 2.08: Domain d6uqoa2: 6uqo A:437-746

Lineage for d6uqoa2 (6uqo A:437-746)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein automated matches [190766] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [384333] (3 PDB entries)

8. Domain d6uqoa2: 6uqo A:437-746 [384447]
   Other proteins in same PDB: d6uqog_, d6uqoh_, d6uqoi_, d6uqoj_, d6uqok_, d6uqol_, d6uqom_, d6uqon_, d6uqoo_, d6uqop_, d6uqoq_, d6uqor_, d6uqos_, d6uqot_
   automated match to d1r6bx3
   complexed with adp, ags

Details for d6uqoa2

PDB Entry: 6uqo, 3.1 Å

PDB Description: clpa/clpp engaged state bound to repa-gfp

PDB Compounds: (A:) ATP-dependent clp protease ATP-binding subunit clpa

SCOPe Domain Sequences for d6uqoa2:

Sequence; same for both SEQRES and ATOM records:

>d6uqoa2 c.37.1.20 (A:437-746) automated matches {Escherichia coli [TaxId: 83333]}
peksvsqsdrdtlknlgdrlkmlvfgqdkaiealteaikmaraglghehkpvgsflfagp
tgvgktevtvqlskalgiellrfdmseymerhtvsrligappgyvgfdqgglltdavikh
phavllldeiekahpdvfnillqvmdngtltdnngrkadfrnvvlvmttnagvreterks
iglihqdnstdameeikkiftpefrnrldniiwfdhlstdvihqvvdkfivelqvqldqk
gvslevsqearnwlaekgydramgarpmarviqdnlkkplanellfgslvdggqvtvald
kekneltygf

Timeline for d6uqoa2:

• d6uqoa2 first appeared in SCOPe 2.07