Lineage for d6uqoq_ (6uqo Q:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852778Species Escherichia coli [TaxId:83333] [376807] (4 PDB entries)
  8. 2852817Domain d6uqoq_: 6uqo Q: [384424]
    Other proteins in same PDB: d6uqoa1, d6uqoa2, d6uqob1, d6uqob2, d6uqoc1, d6uqoc2, d6uqod1, d6uqod2, d6uqoe1, d6uqoe2, d6uqof1, d6uqof2
    automated match to d1yg6a_
    complexed with adp, ags

Details for d6uqoq_

PDB Entry: 6uqo (more details), 3.1 Å

PDB Description: clpa/clpp engaged state bound to repa-gfp
PDB Compounds: (Q:) ATP-dependent Clp endopeptidase proteolytic subunit ClpP

SCOPe Domain Sequences for d6uqoq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uqoq_ c.14.1.1 (Q:) automated matches {Escherichia coli [TaxId: 83333]}
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilthr

SCOPe Domain Coordinates for d6uqoq_:

Click to download the PDB-style file with coordinates for d6uqoq_.
(The format of our PDB-style files is described here.)

Timeline for d6uqoq_: