Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Escherichia coli [TaxId:83333] [376807] (4 PDB entries) |
Domain d6uqoq_: 6uqo Q: [384424] Other proteins in same PDB: d6uqoa1, d6uqoa2, d6uqob1, d6uqob2, d6uqoc1, d6uqoc2, d6uqod1, d6uqod2, d6uqoe1, d6uqoe2, d6uqof1, d6uqof2 automated match to d1yg6a_ complexed with adp, ags |
PDB Entry: 6uqo (more details), 3.1 Å
SCOPe Domain Sequences for d6uqoq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uqoq_ c.14.1.1 (Q:) automated matches {Escherichia coli [TaxId: 83333]} alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav eyglvdsilthr
Timeline for d6uqoq_: