SCOP 1.59: Domain d1fapa_: 1fap A:

Lineage for d1fapa_ (1fap A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)

4. Superfamily d.26.1: FKBP-like [54534] (2 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (29 PDB entries)

8. Domain d1fapa_: 1fap A: [38410]
   Other proteins in same PDB: d1fapb_

Details for d1fapa_

PDB Entry: 1fap, 2.7 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap

SCOP Domain Sequences for d1fapa_:

Sequence; same for both SEQRES and ATOM records:

>d1fapa_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1fapa_:

• d1fapa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fapa_ appears in SCOP 1.57
  
• d1fapa_ appears in SCOP 1.61
  
• d1fapa_ appears in the current release, SCOPe 2.08