Lineage for d1fapb_ (1fap B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96219Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 96350Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
  5. 96351Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (1 protein)
  6. 96352Protein FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47214] (1 species)
  7. 96353Species Human (Homo sapiens) [TaxId:9606] [47215] (6 PDB entries)
  8. 96360Domain d1fapb_: 1fap B: [16618]
    Other proteins in same PDB: d1fapa_

Details for d1fapb_

PDB Entry: 1fap (more details), 2.7 Å

PDB Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap

SCOP Domain Sequences for d1fapb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fapb_ a.24.7.1 (B:) FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) {Human (Homo sapiens)}
rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
lmeaqewcrkymksgnvkdltqawdlyyhvfrris

SCOP Domain Coordinates for d1fapb_:

Click to download the PDB-style file with coordinates for d1fapb_.
(The format of our PDB-style files is described here.)

Timeline for d1fapb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fapa_