PDB entry 1fap

View 1fap on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Deposited on 1996-03-15, released 1997-07-23
The last revision prior to the SCOP 1.59 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.193
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fapa_
  • Chain 'B':
    Domains in SCOP 1.59: d1fapb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fapA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fapB (B:)
    rvailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrd
    lmeaqewcrkymksgnvkdltqawdlyyhvfrris