![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) cis-trans prolyl-isomerase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries) |
![]() | Domain d1d7hb_: 1d7h B: [38399] complexed with dms, nh4, so4 |
PDB Entry: 1d7h (more details), 1.9 Å
SCOPe Domain Sequences for d1d7hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7hb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d1d7hb_: