PDB entry 1d7h
View 1d7h on RCSB PDB site
Description: fkbp complexed with dmso
Class: isomerase
Keywords: isomerase, immunophilin, dmso, fkbp
Deposited on
1999-10-18, released
1999-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-04, with a file datestamp of
2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (fk506-binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1d7ha_ - Chain 'B':
Compound: protein (fk506-binding protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1d7hb_ - Heterogens: NH4, SO4, DMS, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1d7hA (A:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1d7hB (B:)
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle