PDB entry 1d7h

View 1d7h on RCSB PDB site
Description: fkbp complexed with dmso
Class: isomerase
Keywords: isomerase, immunophilin, dmso, fkbp
Deposited on 1999-10-18, released 1999-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fk506-binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d7ha_
  • Chain 'B':
    Compound: protein (fk506-binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d7hb_
  • Heterogens: NH4, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7hA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7hB (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle