Lineage for d1gfla_ (1gfl A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) Protein Green fluorescent protein, GFP [54513] (6 species) Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
Uniprot P42212
Domain d1gfla_: 1gfl A: [38341]
Details for d1gfla_
PDB Entry: 1gfl (more details), 1.9 Å
PDB Description: structure of green fluorescent protein
PDB Compounds: (A:) Green fluorescent proteinSCOPe Domain Sequences for d1gfla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfla_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
askgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttfsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
SCOPe Domain Coordinates for d1gfla_:
Click to download the PDB-style file with coordinates for d1gfla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gfla_:
- d1gfla_ first appeared (with stable ids) in SCOP 1.55
- d1gfla_ appears in SCOPe 2.07
View in 3D
