SCOP 1.73: Domain d2e2ca_: 2e2c A:

Lineage for d2e2ca_ (2e2c A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)

7. Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (1 PDB entry)

8. Domain d2e2ca_: 2e2c A: [38336]

Details for d2e2ca_

PDB Entry: 2e2c, 2 Å

PDB Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins

PDB Compounds: (A:) ubiquitin conjugating enzyme

SCOP Domain Sequences for d2e2ca_:

Sequence; same for both SEQRES and ATOM records:

>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]}
mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
pnnasplnaqaadmwsnqteykkvlhekyktaqsdk

Timeline for d2e2ca_:

• d2e2ca_ first appeared (with stable ids) in SCOP 1.55, called d2e2c__
  
• d2e2ca_ was called d2e2c__ in SCOP 1.71
  
• d2e2ca_ appears in SCOP 1.75
  
• d2e2ca_ appears in the current release, SCOPe 2.08