Lineage for d2e2c__ (2e2c -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (7 species) 
Species Clam (Spisula solidissima), E-2C [TaxId:6584] [54504] (1 PDB entry) 
Domain d2e2c__: 2e2c - [38336]
Details for d2e2c__
PDB Entry: 2e2c (more details), 2 Å
PDB Description: e2-c, an ubiquitin conjugating enzyme required for the destruction of mitotic cyclins
SCOP Domain Sequences for d2e2c__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2c__ d.20.1.1 (-) Ubiquitin conjugating enzyme {Clam (Spisula solidissima), E-2C}
mttskerhsvskrlqqelrtllmsgdpgitafpdgdnlfkwvatldgpkdtvyeslkykl
tlefpsdypykppvvkfttpcwhpnvdqsgnicldilkenwtasydvrtillslqsllge
pnnasplnaqaadmwsnqteykkvlhekyktaqsdk
SCOP Domain Coordinates for d2e2c__:
Click to download the PDB-style file with coordinates for d2e2c__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2e2c__:
- d2e2c__ appears in SCOP 1.57
- d2e2c__ appears in the current release, SCOPe 2.08, called d2e2ca_
View in 3D