Lineage for d6u49c_ (6u49 C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022605Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 3022606Protein Alpha-hemolysin [56961] (2 species)
  7. 3022607Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries)
  8. 3022645Domain d6u49c_: 6u49 C: [382823]
    automated match to d7ahla_
    complexed with pqj, so4

Details for d6u49c_

PDB Entry: 6u49 (more details), 2.35 Å

PDB Description: structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant s. aureus
PDB Compounds: (C:) alpha-hemolysin

SCOPe Domain Sequences for d6u49c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u49c_ f.6.1.1 (C:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d6u49c_:

Click to download the PDB-style file with coordinates for d6u49c_.
(The format of our PDB-style files is described here.)

Timeline for d6u49c_: