Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
Protein Alpha-hemolysin [56961] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries) |
Domain d6u49f_: 6u49 F: [382806] automated match to d7ahla_ complexed with pqj, so4 |
PDB Entry: 6u49 (more details), 2.35 Å
SCOPe Domain Sequences for d6u49f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u49f_ f.6.1.1 (F:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]} adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
Timeline for d6u49f_: