SCOPe 2.08: Domain d6u49f_: 6u49 F:

Lineage for d6u49f_ (6u49 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (3 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
   automatically mapped to Pfam PF07968

6. Protein Alpha-hemolysin [56961] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries)

8. Domain d6u49f_: 6u49 F: [382806]
   automated match to d7ahla_
   complexed with pqj, so4

Details for d6u49f_

PDB Entry: 6u49, 2.35 Å

PDB Description: structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant s. aureus

PDB Compounds: (F:) alpha-hemolysin

SCOPe Domain Sequences for d6u49f_:

Sequence; same for both SEQRES and ATOM records:

>d6u49f_ f.6.1.1 (F:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d6u49f_:

• d6u49f_ first appeared in SCOPe 2.07