Lineage for d1a6za2 (1a6z A:4-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938517Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species)
  7. 2938518Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries)
  8. 2938519Domain d1a6za2: 1a6z A:4-181 [38280]
    Other proteins in same PDB: d1a6za1, d1a6zb_, d1a6zc1, d1a6zd_

Details for d1a6za2

PDB Entry: 1a6z (more details), 2.6 Å

PDB Description: hfe (human) hemochromatosis protein
PDB Compounds: (A:) hfe

SCOPe Domain Sequences for d1a6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6za2 d.19.1.1 (A:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

SCOPe Domain Coordinates for d1a6za2:

Click to download the PDB-style file with coordinates for d1a6za2.
(The format of our PDB-style files is described here.)

Timeline for d1a6za2: