| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries) |
| Domain d1a6zc1: 1a6z C:182-275 [20783] Other proteins in same PDB: d1a6za2, d1a6zb_, d1a6zc2, d1a6zd_ |
PDB Entry: 1a6z (more details), 2.6 Å
SCOPe Domain Sequences for d1a6zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6zc1 b.1.1.2 (C:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw
Timeline for d1a6zc1:
View in 3DDomains from other chains: (mouse over for more information) d1a6za1, d1a6za2, d1a6zb_, d1a6zd_ |