SCOPe 2.08: Domain d1a6za1: 1a6z A:182-275

Lineage for d1a6za1 (1a6z A:182-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)

8. Domain d1a6za1: 1a6z A:182-275 [20781]
   Other proteins in same PDB: d1a6za2, d1a6zb_, d1a6zc2, d1a6zd_

Details for d1a6za1

PDB Entry: 1a6z, 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

PDB Compounds: (A:) hfe

SCOPe Domain Sequences for d1a6za1:

Sequence; same for both SEQRES and ATOM records:

>d1a6za1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

Timeline for d1a6za1:

• d1a6za1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6za1 appears in SCOPe 2.07