Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein automated matches [190658] (12 species) not a true protein |
Species Hepacivirus c [TaxId:11103] [355696] (21 PDB entries) |
Domain d6piza1: 6piz A:1004-1179 [381790] Other proteins in same PDB: d6piza2 automated match to d5epna_ complexed with edo, gol, on4, so4, zn |
PDB Entry: 6piz (more details), 1.89 Å
SCOPe Domain Sequences for d6piza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6piza1 b.47.1.3 (A:1004-1179) automated matches {Hepacivirus c [TaxId: 11103]} tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr gsllsprpisylkgssggpllcpaghavgifraavstrgvakavafipveslettm
Timeline for d6piza1: