Lineage for d6piza1 (6piz A:1004-1179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797067Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2797157Protein automated matches [190658] (12 species)
    not a true protein
  7. 2797169Species Hepacivirus c [TaxId:11103] [355696] (21 PDB entries)
  8. 2797174Domain d6piza1: 6piz A:1004-1179 [381790]
    Other proteins in same PDB: d6piza2
    automated match to d5epna_
    complexed with edo, gol, on4, so4, zn

Details for d6piza1

PDB Entry: 6piz (more details), 1.89 Å

PDB Description: crystal structure of hcv ns3/4a d168a protease in complex with p4-1 (nr02-24)
PDB Compounds: (A:) NS3/4A protease

SCOPe Domain Sequences for d6piza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6piza1 b.47.1.3 (A:1004-1179) automated matches {Hepacivirus c [TaxId: 11103]}
tayaqqtrgeegcqetsqtgrdknqvegevqivstatqtflatsingvlwtvyhgagtrt
iaspkgpvtqmytnvdkdlvgwqapqgsrsltpctcgssdlylvtrhadvipvrrrgdsr
gsllsprpisylkgssggpllcpaghavgifraavstrgvakavafipveslettm

SCOPe Domain Coordinates for d6piza1:

Click to download the PDB-style file with coordinates for d6piza1.
(The format of our PDB-style files is described here.)

Timeline for d6piza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6piza2