SCOPe 2.08: Domain d6rfva1: 6rfv A:246-320

Lineage for d6rfva1 (6rfv A:246-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)

8. Domain d6rfva1: 6rfv A:246-320 [381125]
   Other proteins in same PDB: d6rfva2, d6rfvb2, d6rfvc_, d6rfvd_
   automated match to d2c2aa1
   complexed with adp, mg, so4

Details for d6rfva1

PDB Entry: 6rfv, 2.83 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853-rr468 ph 7

PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d6rfva1:

Sequence; same for both SEQRES and ATOM records:

>d6rfva1 a.30.2.0 (A:246-320) automated matches {Thermotoga maritima [TaxId: 243274]}
ridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnhlenl
lnelldfsrlerksl

Timeline for d6rfva1:

• d6rfva1 first appeared in SCOPe 2.07