Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries) |
Domain d6rfvc_: 6rfv C: [381042] Other proteins in same PDB: d6rfva1, d6rfva2, d6rfvb1, d6rfvb2 automated match to d3dgec_ complexed with adp, mg, so4 |
PDB Entry: 6rfv (more details), 2.83 Å
SCOPe Domain Sequences for d6rfvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rfvc_ c.23.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 2336]} skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivldimmpvmdg ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
Timeline for d6rfvc_: