Lineage for d3stdb_ (3std B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.1: Scytalone dehydratase [54428] (1 protein) Protein Scytalone dehydratase [54429] (1 species) Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (7 PDB entries) 
Domain d3stdb_: 3std B: [38074]
Details for d3stdb_
PDB Entry: 3std (more details), 1.65 Å
PDB Description: scytalone dehydratase and cyanocinnoline inhibitor
SCOP Domain Sequences for d3stdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stdb_ d.17.4.1 (B:) Scytalone dehydratase {Fungus (Magnaporthe grisea)}
geitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg
mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah
sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfg
SCOP Domain Coordinates for d3stdb_:
Click to download the PDB-style file with coordinates for d3stdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3stdb_:
- d3stdb_ appears in SCOP 1.57
- d3stdb_ appears in the current release, SCOPe 2.08
View in 3D
