SCOPe 2.08: Domain d6sdfb1: 6sdf B:3-58

Lineage for d6sdfb1 (6sdf B:3-58)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d6sdfb1: 6sdf B:3-58 [379735]
   Other proteins in same PDB: d6sdfa2, d6sdfa3, d6sdfb2
   automated match to d2a37a_
   complexed with cl, mpd

Details for d6sdfb1

PDB Entry: 6sdf, 2.5 Å

PDB Description: n-terminal sh3 domain of grb2 protein

PDB Compounds: (B:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d6sdfb1:

Sequence; same for both SEQRES and ATOM records:

>d6sdfb1 b.34.2.1 (B:3-58) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaiakydfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemkp

Timeline for d6sdfb1:

• d6sdfb1 first appeared in SCOPe 2.07