Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
Domain d6sdfb1: 6sdf B:3-58 [379735] Other proteins in same PDB: d6sdfa2, d6sdfa3, d6sdfb2 automated match to d2a37a_ complexed with cl, mpd |
PDB Entry: 6sdf (more details), 2.5 Å
SCOPe Domain Sequences for d6sdfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sdfb1 b.34.2.1 (B:3-58) automated matches {Human (Homo sapiens) [TaxId: 9606]} eaiakydfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemkp
Timeline for d6sdfb1: