Lineage for d6sdfa1 (6sdf A:3-60)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783282Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)
  8. 2783322Domain d6sdfa1: 6sdf A:3-60 [379681]
    Other proteins in same PDB: d6sdfa2, d6sdfa3, d6sdfb2
    automated match to d2a37a_
    complexed with cl, mpd

Details for d6sdfa1

PDB Entry: 6sdf (more details), 2.5 Å

PDB Description: n-terminal sh3 domain of grb2 protein
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d6sdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sdfa1 b.34.2.1 (A:3-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaiakydfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemkphp

SCOPe Domain Coordinates for d6sdfa1:

Click to download the PDB-style file with coordinates for d6sdfa1.
(The format of our PDB-style files is described here.)

Timeline for d6sdfa1: