Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187287] (9 PDB entries) |
Domain d6nbwp_: 6nbw P: [379532] Other proteins in same PDB: d6nbwa1, d6nbwa2 automated match to d2vk3a_ complexed with atp, ca, gol, lab, mes, sop |
PDB Entry: 6nbw (more details), 2.5 Å
SCOPe Domain Sequences for d6nbwp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nbwp_ d.110.1.1 (P:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyvn gltlggqkcsvirdsllqdgefsmdlrtkstggaptfnvtvtktdktlvllmgkegvhgg linkkcyemashlrrsqy
Timeline for d6nbwp_: