Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (11 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188780] (1 PDB entry) |
Domain d2vk3a_: 2vk3 A: [168663] automated match to d1d1ja_ complexed with dtu, gol, so4 |
PDB Entry: 2vk3 (more details), 1.7 Å
SCOPe Domain Sequences for d2vk3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vk3a_ d.110.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsmagwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpaeidviigkdreg fftngltlggkkcsvirdslyvdsdctmdirtksqggeptynvavgragrvlvfvmgkeg vhggglnkkaysmakylrdsgf
Timeline for d2vk3a_: