SCOPe 2.07: Domain d6nbwa1: 6nbw A:2-146

Lineage for d6nbwa1 (6nbw A:2-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Homo sapiens [TaxId:9606] [379534] (1 PDB entry)

8. Domain d6nbwa1: 6nbw A:2-146 [379535]
   Other proteins in same PDB: d6nbwp_
   automated match to d1hlua1
   complexed with atp, ca, gol, lab, mes, sop

Details for d6nbwa1

PDB Entry: 6nbw, 2.5 Å

PDB Description: ternary complex of beta/gamma-actin with profilin and ancoa-naa80

PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d6nbwa1:

Sequence, based on SEQRES records:

>d6nbwa1 c.55.1.1 (A:2-146) Actin {Homo sapiens [TaxId: 9606]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6nbwa1 c.55.1.1 (A:2-146) Actin {Homo sapiens [TaxId: 9606]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhgqkdsyvgdeaqskrgiltlk
ypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfn
tpamyvaiqavlslyasg

Timeline for d6nbwa1:

• d6nbwa1 is new in SCOPe 2.07-stable
  
• d6nbwa1 appears in the current release, SCOPe 2.08