Lineage for d6nbwa1 (6nbw A:2-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491252Protein Actin [53073] (10 species)
  7. 2491280Species Homo sapiens [TaxId:9606] [379534] (1 PDB entry)
  8. 2491281Domain d6nbwa1: 6nbw A:2-146 [379535]
    Other proteins in same PDB: d6nbwp_
    automated match to d1hlua1
    complexed with atp, ca, gol, lab, mes, sop

Details for d6nbwa1

PDB Entry: 6nbw (more details), 2.5 Å

PDB Description: ternary complex of beta/gamma-actin with profilin and ancoa-naa80
PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d6nbwa1:

Sequence, based on SEQRES records: (download)

>d6nbwa1 c.55.1.1 (A:2-146) Actin {Homo sapiens [TaxId: 9606]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqsk
rgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtq
imfetfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d6nbwa1 c.55.1.1 (A:2-146) Actin {Homo sapiens [TaxId: 9606]}
dddiaalvvdngsgmckagfagddapravfpsivgrprhgqkdsyvgdeaqskrgiltlk
ypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfn
tpamyvaiqavlslyasg

SCOPe Domain Coordinates for d6nbwa1:

Click to download the PDB-style file with coordinates for d6nbwa1.
(The format of our PDB-style files is described here.)

Timeline for d6nbwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nbwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6nbwp_