SCOPe 2.07: Domain d1cc2a2: 1cc2 A:319-450

Lineage for d1cc2a2 (1cc2 A:319-450)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (3 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)

8. Domain d1cc2a2: 1cc2 A:319-450 [37868]
   Other proteins in same PDB: d1cc2a1
   complexed with fad; mutant

Details for d1cc2a2

PDB Entry: 1cc2, 2.2 Å

PDB Description: cholesterol oxidase from streptomyces his447gln mutant

PDB Compounds: (A:) protein (cholesterol oxidase)

SCOPe Domain Sequences for d1cc2a2:

Sequence; same for both SEQRES and ATOM records:

>d1cc2a2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyqplg

Timeline for d1cc2a2:

• d1cc2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1cc2a2 appears in SCOPe 2.06
  
• d1cc2a2 appears in the current release, SCOPe 2.08