Lineage for d1cc2a2 (1cc2 A:319-450)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30801Family d.16.1.1: Cholesterol oxidase [54374] (1 protein)
  6. 30802Protein Cholesterol oxidase [54375] (2 species)
  7. 30806Species Streptomyces sp. [TaxId:1931] [54377] (4 PDB entries)
  8. 30810Domain d1cc2a2: 1cc2 A:319-450 [37868]
    Other proteins in same PDB: d1cc2a1

Details for d1cc2a2

PDB Entry: 1cc2 (more details), 2.2 Å

PDB Description: cholesterol oxidase from streptomyces his447gln mutant

SCOP Domain Sequences for d1cc2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc2a2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyqplg

SCOP Domain Coordinates for d1cc2a2:

Click to download the PDB-style file with coordinates for d1cc2a2.
(The format of our PDB-style files is described here.)

Timeline for d1cc2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cc2a1