Lineage for d1cc2a2 (1cc2 A:319-450)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504387Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2504388Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2504389Family d.16.1.1: GMC oxidoreductases [54374] (5 protein domains)
  6. 2504390Protein Cholesterol oxidase [54375] (3 species)
  7. 2504396Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)
  8. 2504410Domain d1cc2a2: 1cc2 A:319-450 [37868]
    Other proteins in same PDB: d1cc2a1
    complexed with fad; mutant

Details for d1cc2a2

PDB Entry: 1cc2 (more details), 2.2 Å

PDB Description: cholesterol oxidase from streptomyces his447gln mutant
PDB Compounds: (A:) protein (cholesterol oxidase)

SCOPe Domain Sequences for d1cc2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc2a2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyqplg

SCOPe Domain Coordinates for d1cc2a2:

Click to download the PDB-style file with coordinates for d1cc2a2.
(The format of our PDB-style files is described here.)

Timeline for d1cc2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cc2a1