Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins) |
Protein Cholesterol oxidase [54375] (2 species) |
Species Streptomyces sp. [TaxId:1931] [54377] (10 PDB entries) |
Domain d1cc2a2: 1cc2 A:319-450 [37868] Other proteins in same PDB: d1cc2a1 complexed with fad; mutant |
PDB Entry: 1cc2 (more details), 2.2 Å
SCOP Domain Sequences for d1cc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cc2a2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.} gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk afaddfcyqplg
Timeline for d1cc2a2: