Lineage for d1cc2a1 (1cc2 A:9-318,A:451-506)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576341Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (14 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 576342Protein Cholesterol oxidase of GMC family [51914] (2 species)
  7. 576346Species Streptomyces sp. [TaxId:1931] [51916] (10 PDB entries)
  8. 576356Domain d1cc2a1: 1cc2 A:9-318,A:451-506 [30337]
    Other proteins in same PDB: d1cc2a2
    complexed with fad; mutant

Details for d1cc2a1

PDB Entry: 1cc2 (more details), 2.2 Å

PDB Description: cholesterol oxidase from streptomyces his447gln mutant

SCOP Domain Sequences for d1cc2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc2a1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp.}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdv

SCOP Domain Coordinates for d1cc2a1:

Click to download the PDB-style file with coordinates for d1cc2a1.
(The format of our PDB-style files is described here.)

Timeline for d1cc2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cc2a2