Lineage for d5qiza_ (5qiz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927422Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
    probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model
  6. 2927426Protein automated matches [197305] (1 species)
    not a true protein
  7. 2927427Species Human (Homo sapiens) [TaxId:9606] [197306] (13 PDB entries)
  8. 2927437Domain d5qiza_: 5qiz A: [378365]
    automated match to d4fjva_
    complexed with j64, unl

Details for d5qiza_

PDB Entry: 5qiz (more details), 1.63 Å

PDB Description: covalent fragment group deposition -- crystal structure of outb2 in complex with pcm-0103080
PDB Compounds: (A:) Ubiquitin thioesterase OTUB2

SCOPe Domain Sequences for d5qiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qiza_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesll
gksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndq
sasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsq
alsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilya

SCOPe Domain Coordinates for d5qiza_:

Click to download the PDB-style file with coordinates for d5qiza_.
(The format of our PDB-style files is described here.)

Timeline for d5qiza_: