SCOP 1.55: Domain d2gb1__: 2gb1 -

Lineage for d2gb1__ (2gb1 -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries)

8. Domain d2gb1__: 2gb1 - [37834]

Details for d2gb1__

PDB Entry: 2gb1

PDB Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g

SCOP Domain Sequences for d2gb1__:

Sequence; same for both SEQRES and ATOM records:

>d2gb1__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d2gb1__:

• d2gb1__ appears in SCOP 1.57
  
• d2gb1__ appears in the current release, SCOPe 2.08, called d2gb1a_